PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00034737-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family HSF
Protein Properties Length: 81aa    MW: 9239.38 Da    PI: 6.2208
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00034737-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind77.62.1e-241876260
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
      HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                      F+ k+y++++d+++++++sw ++ nsfvv+++eef+ ++L +yF hsnf+SFvRQLn+Y
  PSME_00034737-RA 18 FMVKTYRLVDDPSTNHIVSWGDRHNSFVVWNPEEFSVSILLSYFNHSNFSSFVRQLNTY 76
                      99********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.7E-251376IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.7E-151481IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.63E-221776IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000562.2E-111841IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004477.7E-201876IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-115668IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.2E-116981IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MGESGGFTDA GRLVAAPFMV KTYRLVDDPS TNHIVSWGDR HNSFVVWNPE EFSVSILLSY  60
FNHSNFSSFV RQLNTYVCIL Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5w_B5e-151576162Putative transcription factor
5d5x_B5e-151576162Putative transcription factor
5d5x_E5e-151576162Putative transcription factor
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010530513.14e-26PREDICTED: heat stress transcription factor B-4-like
SwissprotQ9C6352e-27HSFB4_ARATH; Heat stress transcription factor B-4
TrEMBLH9WUJ05e-29H9WUJ0_PINTA; Uncharacterized protein (Fragment)
TrEMBLH9WUJ35e-29H9WUJ3_PINTA; Uncharacterized protein (Fragment)
TrEMBLH9WUJ66e-29H9WUJ6_PINTA; Uncharacterized protein (Fragment)
STRINGSolyc11g064990.1.17e-26(Solanum lycopersicum)
STRINGGSMUA_Achr9P15370_0012e-25(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.11e-28heat shock transcription factor B4